PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G1399
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 263aa    MW: 28892.1 Da    PI: 7.4658
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G1399genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
      Gh_A13G1399 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding41.82.4e-1367112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++ +k++w+++l
      Gh_A13G1399  67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNGIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.316965IPR017930Myb domain
SuperFamilySSF466892.13E-3011108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002494.1E-161461IPR001005SANT/Myb domain
CDDcd001674.07E-121661No hitNo description
Gene3DG3DSA:1.10.10.604.7E-2465116IPR009057Homeodomain-like
SMARTSM007174.4E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129417.57866116IPR017930Myb domain
PfamPF002499.1E-1267112IPR001005SANT/Myb domain
CDDcd001673.09E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNGIKNYWNT HLKKKLRKFQ  120
SAMEPPSMAG DEKSLDFAES ETGAGSSNLK LNQTSSSYAS STENISRLLQ GWMRSSPKIN  180
NNNNSDSIGS CSAAANNDLI SHGDDQLEXS DSIGSCSAAA NNDLISHGDD QLESILSFEN  240
MKDVALMEKS TSKATFQDSG TIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.168661e-165boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465520.11e-163PREDICTED: myb-related protein 306-like
SwissprotP813926e-85MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B0MDL61e-163A0A0B0MDL6_G
STRINGPOPTR_0013s06390.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.14e-97myb domain protein 60